bonanova Posted May 24, 2012 Report Share Posted May 24, 2012 Among the six character strings below, which is the most different?ILMRVMPRSVLMQRSLMRSVKLRSVCLMSV Quote Link to comment Share on other sites More sharing options...
0 depew33 Posted May 24, 2012 Report Share Posted May 24, 2012 Reveal hidden contents #1 This is the only string that has a vowel in it. Quote Link to comment Share on other sites More sharing options...
0 thebalrog17 Posted May 24, 2012 Report Share Posted May 24, 2012 Reveal hidden contents ILMRV has b=3, c=3, d=4, e=3, f=3 similarities MPRSV has a=3, c=3, d=4, e=3, f=3 similarities LMQRS has a=3, b=3, d=4, e=3, f=3 similarities LMRSV has a=4, b=4, c=4, e=4, f=4 similarities KLRSV has a=3, b=3, c=3, d=4, f=3 similarities CLMSV has a=3, b=3, c=3, d=4, e=3 similarities So the answer is line 4 LMRSV 1 Quote Link to comment Share on other sites More sharing options...
0 plainglazed Posted May 24, 2012 Report Share Posted May 24, 2012 my GUESS is it is six... Quote Link to comment Share on other sites More sharing options...
0 depew33 Posted May 24, 2012 Report Share Posted May 24, 2012 On 5/24/2012 at 12:39 PM, thebalrog17 said: Reveal hidden contents ILMRV has b=3, c=3, d=4, e=3, f=3 similarities MPRSV has a=3, c=3, d=4, e=3, f=3 similarities LMQRS has a=3, b=3, d=4, e=3, f=3 similarities LMRSV has a=4, b=4, c=4, e=4, f=4 similarities KLRSV has a=3, b=3, c=3, d=4, f=3 similarities CLMSV has a=3, b=3, c=3, d=4, e=3 similarities So the answer is line 4 LMRSV Reveal hidden contents This seems like the string that has the most similarities to all the other strings. The question asks for which is the most different. Quote Link to comment Share on other sites More sharing options...
0 Prof. Templeton Posted May 24, 2012 Report Share Posted May 24, 2012 Reveal hidden contents Reveal hidden contents Because it shares two letters in common with the word "different" while all other strings share just one. It is therefore the most "different" Reveal hidden contents It is the only string with a 10 point Scrabble® letter. Reveal hidden contents Adding adjacent roman numerals and allowing single and adjacent non-roman numerals to be minus signs, this string has the largest difference. I've got more. Quote Link to comment Share on other sites More sharing options...
0 plasmid Posted May 24, 2012 Report Share Posted May 24, 2012 On 5/24/2012 at 2:50 PM, Prof. Templeton said: Reveal hidden contents Reveal hidden contents Because it shares two letters in common with the word "different" while all other strings share just one. It is therefore the most "different" Reveal hidden contents It is the only string with a 10 point Scrabble® letter. Reveal hidden contents Adding adjacent roman numerals and allowing single and adjacent non-roman numerals to be minus signs, this string has the largest difference. I've got more. Reveal hidden contents If these are protein sequences that have been aligned and are portions of larger proteins, then the most highly conserved amino acid (and therefore the one I would most expect to be critical for the protein's function) is the V (valine) at the last position. Since sequence #3 has an S (serine) there instead, I would guess that #3 has a different function than the others and would in my eyes be most different. If these are protein sequences that are not necessarily correctly aligned, I would say that #6 is the most unlike the others because it has no charged resides, is mostly non-polar except for a serine, and it's the only one that has a cysteine capable of disulfide bonding. I noticed that there were no B, J, O, U, X, or Z in these sequences, going along with the theory of them being amino acids. Quote Link to comment Share on other sites More sharing options...
0 Molly Mae Posted May 24, 2012 Report Share Posted May 24, 2012 Reveal hidden contents If the strings are read from top to bottom instead of left to right, the first column is most different. It's all numbers! =D Quote Link to comment Share on other sites More sharing options...
0 Morningstar Posted May 24, 2012 Report Share Posted May 24, 2012 On 5/24/2012 at 3:23 PM, plasmid said: Reveal hidden contents If these are protein sequences that have been aligned and are portions of larger proteins, then the most highly conserved amino acid (and therefore the one I would most expect to be critical for the protein's function) is the V (valine) at the last position. Since sequence #3 has an S (serine) there instead, I would guess that #3 has a different function than the others and would in my eyes be most different. If these are protein sequences that are not necessarily correctly aligned, I would say that #6 is the most unlike the others because it has no charged resides, is mostly non-polar except for a serine, and it's the only one that has a cysteine capable of disulfide bonding. I noticed that there were no B, J, O, U, X, or Z in these sequences, going along with the theory of them being amino acids. My mind is exploding! ! Quote Link to comment Share on other sites More sharing options...
0 bonanova Posted May 24, 2012 Author Report Share Posted May 24, 2012 The spectrum of approaches here is a worthy display of the best efforts of our Denizens. Truly impressive. Here's the telling clue: The OP referred to the choices as character strings. See comments below. On 5/24/2012 at 12:24 PM, depew33 said: Reveal hidden contents #1 This is the only string that has a vowel in it. Not the distinguishing characteristic I had in mind; it slipped in, due to lack of careful editing. Honorable Mention, nonetheless. On 5/24/2012 at 12:39 PM, thebalrog17 said: Reveal hidden contents ILMRV has b=3, c=3, d=4, e=3, f=3 similarities MPRSV has a=3, c=3, d=4, e=3, f=3 similarities LMQRS has a=3, b=3, d=4, e=3, f=3 similarities LMRSV has a=4, b=4, c=4, e=4, f=4 similarities KLRSV has a=3, b=3, c=3, d=4, f=3 similarities CLMSV has a=3, b=3, c=3, d=4, e=3 similarities So the answer is line 4 LMRSV Correct. Reveal hidden contents More simply]In the six strings there are five unique characters: C I K P Q. Number 4 is the only string without an occurrence. On 5/24/2012 at 12:49 PM, plainglazed said: my GUESS is it is six... Certainly the one that initially appears to be different. On 5/24/2012 at 1:02 PM, depew33 said: Reveal hidden contents This seems like the string that has the most similarities to all the other strings. The question asks for which is the most different. If one string is extremal with respect to property X, it then differs from all the others in that regard. In this case, X has the value of "sameness." On 5/24/2012 at 2:50 PM, Prof. Templeton said: Reveal hidden contents Reveal hidden contents Because it shares two letters in common with the word "different" while all other strings share just one. It is therefore the most "different" Honorable Mention #2. Nice! Reveal hidden contents It is the only string with a 10 point Scrabble® letter. OMG. Reveal hidden contents Adding adjacent roman numerals and allowing single and adjacent non-roman numerals to be minus signs, this string has the largest difference. Perhaps, but I'm not going to even try to verify that claim. I've got more. Never would doubt it. On 5/24/2012 at 3:23 PM, plasmid said: Reveal hidden contents If these are protein sequences that have been aligned and are portions of larger proteins, then the most highly conserved amino acid (and therefore the one I would most expect to be critical for the protein's function) is the V (valine) at the last position. Since sequence #3 has an S (serine) there instead, I would guess that #3 has a different function than the others and would in my eyes be most different. If these are protein sequences that are not necessarily correctly aligned, I would say that #6 is the most unlike the others because it has no charged resides, is mostly non-polar except for a serine, and it's the only one that has a cysteine capable of disulfide bonding. I noticed that there were no B, J, O, U, X, or Z in these sequences, going along with the theory of them being amino acids. plasmid, I continue to stand in awe ... On 5/24/2012 at 5:19 PM, Molly Mae said: Reveal hidden contents If the strings are read from top to bottom instead of left to right, the first column is most different. It's all numbers! =D And if one is lying down while solving, the first column would then be the most different row. <almost> Honorable Mention. On 5/24/2012 at 5:43 PM, Morningstar said: My mind is exploding! ! Mine, too. Hope this was enjoyable ... good answers all. Quote Link to comment Share on other sites More sharing options...
0 msimpartial Posted May 24, 2012 Report Share Posted May 24, 2012 (edited) On 5/24/2012 at 11:03 AM, bonanova said: Among the six character strings below, which is the most different?ILMRVMPRSVLMQRSLMRSVKLRSVCLMSV Edited May 24, 2012 by msimpartial Quote Link to comment Share on other sites More sharing options...
0 WitchOfDoubt Posted May 25, 2012 Report Share Posted May 25, 2012 Reveal hidden contents Codons: I = AUU; AUC, or AUA L = UUA; UUG; CUU; CUC; CUA; CUG M = AUG Q = CAA CAG R = CGU CGC CGA CGG AGA AGG V = GUU GUC GUA GUG P = CCU CCA CCC CCG S = AGU AGC UCU UCC UCA UCG K = AAA AAG C = UGU UGC We'll define the most different sequence using mutation distance. Assuming the most similar possible sequences, which one requires the largest number of single-base insertions, deletions, or substitutions to produce from any of the others? In addition, assume that the sequence is NOT PARTIAL; it cannot include an extra amino acid at the beginning or end. 1. ILMRV: Can be produced from 6 (CLMSV) using only 3 substitutions: C -> I (using UGU -> AUU, 2 mutations) and S -> R (AGU -> AGG, 1 mutation) 2. MPRSV: Can be produced from 5 (KLRSV) using only 2 substitutions: K -> M (AAG -> AUG) and L -> P (CUU -> CCU) 3. LMQRS: Can be produced from 4 (LMRSV) using 4 substitutions: R -> Q (CGA -> CAA), S-> R (AGU -> AGG), V -> S (GUU -> AGU, 2 mutations). Is there a better way? 4. LMRSV: Can be produced from 5, (KLRSV), using 3 substitutions: using K -> L (AAA -> CUA, 2 mutations), L-> M (UUG -> AUG). 5. Can be produced from 2 in 2 substitutions. 6. Can be produced from 1 using 3 substitutions. So if we go by substitutions, 3 is the most different. But if the sequences are partial, it can be made with a 3-base insertion to 4... Quote Link to comment Share on other sites More sharing options...
Question
bonanova
Among the six character strings below, which is the most different?
Link to comment
Share on other sites
11 answers to this question
Recommended Posts
Join the conversation
You can post now and register later. If you have an account, sign in now to post with your account.